DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and al

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:391 Identity:113/391 - (28%)
Similarity:153/391 - (39%) Gaps:121/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 ESRIEELKQSQPGIFSWEIRAKLIEAG---VCDKQNAPSVSS------ISRLLRGSSGSGTSHSI 154
            |.::|||.|          .|||....   :.|:....|.:|      :|..:.|.:.||.|   
  Fly     6 EIKLEELPQ----------EAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGAS--- 57

  Fly   155 DGILGGGAGSV--GSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREE 217
             |..||....|  |:.|...|:..|    ||||||.||||::.|::.||:.|:||.||||:||||
  Fly    58 -GASGGTNSPVSDGNSDCEADEYAP----KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREE 117

  Fly   218 LAQSTGLTEARVQVWFSNRRARLRKQ--LNTQQVPSFAPTSTSFGATPTT--SAAPAPN----MG 274
            ||...||||||:||||.||||:.|||  :..|..| :.|......||..|  .||..||    :|
  Fly   118 LAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHP-YNPYLPGGAATMQTVVGAALPPNPFTHLG 181

  Fly   275 MSL---YSSQ--------SWPSSGA-------YEN-------HAAYGGSVASMSPASS------- 307
            ..|   :.:|        .:|...|       |.|       |....|.....||:||       
  Fly   182 FQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLAN 246

  Fly   308 ----TSGT-----------SSAAHSPVQTQAQQPGTGSEFMTSTYGVGSSNATYPSAAYSMPQTP 357
                ..||           |...|||....|..|.:.:.      |..|.:..:|:|....||.|
  Fly   247 MTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPAS------GHASQHQQHPTAHPPPPQAP 305

  Fly   358 ATSAEQLRSQFASAAASGSHHPSTWDSYNFAGSFFPPASAAGNHISGYHHQVDQKSSMMTTAPTY 422
            ......::                            ||..:..|:.|.  .:.|::|.::...|.
  Fly   306 PQMPVGVQ----------------------------PAQLSPQHLVGI--ALTQQASSLSPTQTS 340

  Fly   423 P 423
            |
  Fly   341 P 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 12/52 (23%)
homeodomain 186..243 CDD:238039 37/56 (66%)
alNP_722629.1 Homeobox 89..141 CDD:278475 34/51 (67%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450980
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.