DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and CG11294

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:169 Identity:60/169 - (35%)
Similarity:80/169 - (47%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 KRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNT 246
            :|:|||:||||:..|:..||.:|.:|.||||:.|||:|....|:||||||||.||||:.|||...
  Fly    21 RRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQARL 85

  Fly   247 QQV-PSFAPTSTSFGATPTT------------SAAPAPNMGMSLYSSQSWPSSGAYENHAAYGGS 298
            |.: .::.....|.|..|..            :.|..|:......||.|..|..|...:....||
  Fly    86 QLLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPSQTPENLSSASKDSELAEVGNGPNSGS 150

  Fly   299 VASMSPASSTSGTSSAAHSPVQTQAQQPGTGSEFMTSTY 337
            ...|.||....      |...|.|..|..|..:.::.||
  Fly   151 FTMMHPAFQQQ------HQQQQHQGHQQATDQDKLSKTY 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 33/56 (59%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 29/50 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450981
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.