DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and oc

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster


Alignment Length:240 Identity:83/240 - (34%)
Similarity:116/240 - (48%) Gaps:42/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 RKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQ 247
            |||||.||||:..|:|.||.:|.:|:|||::.|||:|....|.|:||||||.||||:.|:||..|
  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129

  Fly   248 QVPSFAPTSTSFGATPTTSAAPAPNMGMSLYSSQSWPSSGAYENHAAYGGSVASMSPASSTSGTS 312
            |      .|.|..::...|...:.|         |..||.|.....:.....:|.:...|:.|.:
  Fly   130 Q------QSNSLSSSKNASGGGSGN---------SCSSSSANSRSNSNNNGSSSNNNTQSSGGNN 179

  Fly   313 SAAHSPVQ--TQAQQPGTGSEFMTSTYGVGSSNATYPSAAYSMPQTPATSAEQL----RSQF--- 368
            |...|..|  :|:.|.|.||.        |.:|:...|||.:.....|.:|.|.    .|.|   
  Fly   180 SNKSSQKQGNSQSSQQGGGSS--------GGNNSNNNSAAAAASAAAAVAAAQSIKTHHSSFLSA 236

  Fly   369 ASAAASGSHHPSTWD--SYNFAGSFFPPASA--------AGNHIS 403
            |:|||||..:.|..:  :.|..|:..|.:|:        ||.|:|
  Fly   237 AAAAASGGTNQSANNNSNNNNQGNSTPNSSSSGGGGGSQAGGHLS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 32/56 (57%)
ocNP_001356934.1 Homeobox 71..123 CDD:333795 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450997
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.