DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Dux4

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006252740.1 Gene:Dux4 / 306226 RGDID:1311053 Length:357 Species:Rattus norvegicus


Alignment Length:337 Identity:79/337 - (23%)
Similarity:120/337 - (35%) Gaps:95/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PDIESR---IEELKQSQPGIFSW-----EIRAKLIEAGVCDKQNAPSVSSISRLLRGSSGSGTSH 152
            ||:.:|   .::|..|:..|.:|     :|| |.:|...|.::                      
  Rat    39 PDLATRGHLAKKLGISESQIMTWFQKHRKIR-KQVEFECCSEE---------------------- 80

  Fly   153 SIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREE 217
                          |:::.:|  :|.|   ::..||||.|:..|||.|...|.:.::|.:.|||:
  Rat    81 --------------SQEQGQD--KPRV---KEAGRSRTHFTKFQIDILIEAFEKNRFPGIVTREK 126

  Fly   218 LAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAPTSTSFGATPTT-SAAPA--PNMGMSLYS 279
            |||.||:.|:|:.:||.|||||........:..|..|.|:...|..|| ..||:  |....|:..
  Rat   127 LAQETGIPESRIHIWFQNRRARHPDPKQGTRATSHPPESSQCPAQKTTGQLAPSKDPTSSCSVIL 191

  Fly   280 SQSWPSSGAYENHAAYGGSVASMSPASSTSGTSSAAHSPV---QTQAQQPGTGSEFMTSTYGVGS 341
            ..|.|       |...|....|.........|:....|.|   :...|.|....:.::.....|.
  Rat   192 PLSPP-------HTPNGPLDLSRGRQKQLPETTVLQPSQVVQRRGDDQNPSLFIDHLSEVKSPGE 249

  Fly   342 SNATYPSAAYSMPQTPATSAEQLRSQFASAAASGSHHPSTWDSYNFAGSFFPP------ASAAGN 400
            ....:..|...:|                 .....|:||     ..:|...||      .||...
  Rat   250 KEGFHTQAPLQLP-----------------IQKRGHNPS-----ENSGLSVPPLEDSTQVSAVNQ 292

  Fly   401 HISGYHHQVDQK 412
            |.    .:.|||
  Rat   293 HF----RKPDQK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 12/54 (22%)
homeodomain 186..243 CDD:238039 28/56 (50%)
Dux4XP_006252740.1 homeodomain 15..71 CDD:238039 9/32 (28%)
Homeobox 97..149 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.