DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Mixl1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:217 Identity:64/217 - (29%)
Similarity:92/217 - (42%) Gaps:69/217 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIRPG--VIGGSKPRVATPDI--ESRIEELKQ 107
            |||||      |:||:.:.|..      |....:..||  ::..::|....|..  :||      
  Rat     1 MAAAG------SQQLQFAEGAA------FPTFPAAHPGGQLLPAARPATGLPPAPPDSR------ 47

  Fly   108 SQPGIFSWEIRAKLIEAGVCDKQNAPSVSSI--SRLLRGSSGSGTSHSIDGILGGGAGSVGSEDE 170
                                    ||:.:..  ||..|.::.:.|.....|             .
  Rat    48 ------------------------APAATPCFPSRGPRPAAQTPTGLDPPG-------------P 75

  Fly   171 SEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSN 235
            |:..|.||.    .|||.||:||::|:..||.:|.:|.|||::.||.||..|.|.|:|:||||.|
  Rat    76 SKGSAAPSA----PQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQN 136

  Fly   236 RRARLRKQLNTQQVPSFAPTST 257
            |||:.|:|..    .||.|.|:
  Rat   137 RRAKSRRQSG----KSFQPLSS 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 20/101 (20%)
homeodomain 186..243 CDD:238039 31/56 (55%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 55/195 (28%)
Homeobox 89..143 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.