DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Duxbl1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_899245.1 Gene:Duxbl1 / 278672 MGIID:1916048 Length:350 Species:Mus musculus


Alignment Length:317 Identity:81/317 - (25%)
Similarity:122/317 - (38%) Gaps:74/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PDIESR---IEELKQSQPGIFSW-----EIRAKLIEAGVCDKQNAPSVSSISRLLRGSSGSGTSH 152
            ||:.:|   .:||..|:..|.:|     :|| |..|...|.::                      
Mouse    39 PDLATRGHLAKELGISESQIMTWFQKHRKIR-KQAEFACCSEE---------------------- 80

  Fly   153 SIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREE 217
                          |:::.:|  :|.|   ::.|||||.|:..|.|.|...|.:.::|.:.|||:
Mouse    81 --------------SQEQEQD--KPRV---KEARRSRTHFTKFQTDILIEAFEKNRFPGIVTREK 126

  Fly   218 LAQSTGLTEARVQVWFSNRRARLRKQ-LNTQQVPSFAPTSTSFGATPTTSAAPAPNMGMSLYSSQ 281
            |||.||:.|:|:.:||.|||||.... .|||:.|.  |..:|.|.|..|....||:..::..:|.
Mouse   127 LAQQTGIPESRIHIWFQNRRARHPDPGQNTQKTPH--PPQSSQGPTQKTVGKLAPSKTLTSSASV 189

  Fly   282 SWPSSGAYENHAAYGGSVASMSPASSTSGTSSAAHSPVQTQA---QQPGTGSEFMTSTYGVGSSN 343
            ..|.|   ..|...|....|........||:....|.|..|.   |.|..|....|:|.|....:
Mouse   190 ILPLS---PPHTPNGPLDLSKGRQKQLPGTTLLQSSQVVQQRSDDQNPNKGHLSPTTTPGEQGFH 251

  Fly   344 ATYP--------------SAAYSMPQ-TPATSAEQLRSQFASAAASGSHHPSTWDSY 385
            :..|              |...::|: ...|....:...|.....:.|.....||.:
Mouse   252 SQPPLQLLTQNRGHNPRESGGLAVPRLEDCTQVPAVNQHFRKLDQNDSSFLQHWDEW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 13/54 (24%)
homeodomain 186..243 CDD:238039 28/56 (50%)
Duxbl1NP_899245.1 homeodomain 15..71 CDD:238039 10/32 (31%)
HOX 95..149 CDD:197696 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.