DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Mixl1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_038757.1 Gene:Mixl1 / 27217 MGIID:1351322 Length:231 Species:Mus musculus


Alignment Length:280 Identity:75/280 - (26%)
Similarity:109/280 - (38%) Gaps:90/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIRPGVIGGSKPRVATPDI--ESRIEELKQSQ 109
            |||||      |:||:.:.|....|.......|.:.|.:    :|....|..  :||.....|..
Mouse     1 MAAAG------SQQLQFAEGAAFPIFPAAHPGGQLLPAM----RPASGLPAAPHDSRAPAATQCF 55

  Fly   110 PGIFSWEIRAKLIEAGVCDKQNAPSVSSISRLLRGSSGSGTSHSIDGILGGGAGSVGSEDESEDD 174
            |                 ::.::|:..             |...:|           ....|:..
Mouse    56 P-----------------NRDSSPTAQ-------------TPAGLD-----------PPGPSKGS 79

  Fly   175 AEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRAR 239
            |.||.    .|||.||:||::|:..||.:|.:|.|||::.||.||..|.|.|:|:||||.||||:
Mouse    80 AAPSA----PQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAK 140

  Fly   240 LRKQLNTQQVPSFAPTSTSFGA-----TPTTSA---------------APAPNM---GMSLYSSQ 281
            .|:|..    .||.|.|:..|.     .|.|.|               .|.|:|   |:....||
Mouse   141 SRRQSG----KSFQPLSSRRGVFLHCPAPGTEARCLKPQLPLEADVNHVPDPSMTGGGVCTSGSQ 201

  Fly   282 SWPSSGAYENHAAYGGSVAS 301
            |      :|.:::....:.|
Mouse   202 S------FETYSSLSEDIGS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 19/97 (20%)
homeodomain 186..243 CDD:238039 31/56 (55%)
Mixl1NP_038757.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..93 20/118 (17%)
Homeobox 89..142 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.