DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Gm4981

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001030041.1 Gene:Gm4981 / 245263 MGIID:3645498 Length:291 Species:Mus musculus


Alignment Length:216 Identity:61/216 - (28%)
Similarity:77/216 - (35%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARL-RKQL 244
            ::...||..|..:..|...|.:.|.|...|...||||||..|||.|..:..|..|:|||. |:..
Mouse     1 MRSSSRRPHTGLTLSQRRILAQAFERNPRPGCATREELALETGLPEDMIHTWLKNKRARRHRRGR 65

  Fly   245 NTQQVPSFAPTSTSFGATPTTSAAPAPNMGMSLYSSQSWP-----SSGAYENHAAYGGSVASMSP 304
            .|.|......:..|.||    .|.|. ..|..:....|.|     |:|......:|..|....|.
Mouse    66 PTAQDQDLLASQVSGGA----PAGPV-GRGHEVAQESSLPQEEAGSTGMDTTSTSYSPSFCRESQ 125

  Fly   305 ASSTSGTSSAAHSPVQTQAQQPG-------------TGSEFMTSTYGVGSSNATYPSAAYSMPQT 356
            .|..|....|....|.|||...|             ...|.:.....:||.    |.|     :.
Mouse   126 LSQVSQPRGAGQKEVPTQAGNVGPLELLLDELQDEVQVKEHVPDPLDLGSD----PGA-----RE 181

  Fly   357 PATSAEQLRSQFASAAASGSH 377
            |..|.:.|:| ...||.||.|
Mouse   182 PEGSQDSLQS-LDEAANSGWH 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 24/57 (42%)
Gm4981NP_001030041.1 homeodomain 6..56 CDD:238039 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.