DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and npax-2

DIOPT Version :10

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_508396.3 Gene:npax-2 / 185967 WormBaseID:WBGene00018591 Length:233 Species:Caenorhabditis elegans


Alignment Length:132 Identity:55/132 - (41%)
Similarity:77/132 - (58%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QGQGRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIR 82
            :..|| ||||..:..|.||....|.:||::...|.:.|.||::|.|:|.||||||||:::|||::
 Worm    97 RSSGR-NQLGRTYSPGLPLSMCEREEIVKLFQGGWKICDISKRLCVTHSCVSKILNRYRQTGSVK 160

  Fly    83 PGVIGGSKPRVATP------DIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPSVSSISRL 141
            |.  ...:.|..:|      |..||:...:||       |||.:||..|||.:.||||.|||:.:
 Worm   161 PK--DAKEGRTESPLVLAVRDYRSRLGMCRQS-------EIREQLIRDGVCTRDNAPSRSSINHI 216

  Fly   142 LR 143
            ||
 Worm   217 LR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 53/129 (41%)
Homeodomain 186..242 CDD:459649
npax-2NP_508396.3 PAX 97..218 CDD:128645 53/130 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.