DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and npax-2

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_508396.3 Gene:npax-2 / 185967 WormBaseID:WBGene00018591 Length:233 Species:Caenorhabditis elegans


Alignment Length:132 Identity:55/132 - (41%)
Similarity:77/132 - (58%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QGQGRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCVSKILNRFQETGSIR 82
            :..|| ||||..:..|.||....|.:||::...|.:.|.||::|.|:|.||||||||:::|||::
 Worm    97 RSSGR-NQLGRTYSPGLPLSMCEREEIVKLFQGGWKICDISKRLCVTHSCVSKILNRYRQTGSVK 160

  Fly    83 PGVIGGSKPRVATP------DIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAPSVSSISRL 141
            |.  ...:.|..:|      |..||:...:||       |||.:||..|||.:.||||.|||:.:
 Worm   161 PK--DAKEGRTESPLVLAVRDYRSRLGMCRQS-------EIREQLIRDGVCTRDNAPSRSSINHI 216

  Fly   142 LR 143
            ||
 Worm   217 LR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645 53/129 (41%)
homeodomain 186..243 CDD:238039
npax-2NP_508396.3 PAX 97..218 CDD:128645 53/130 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.