DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and Cphx1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_780551.1 Gene:Cphx1 / 105594 MGIID:2145733 Length:182 Species:Mus musculus


Alignment Length:188 Identity:42/188 - (22%)
Similarity:76/188 - (40%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLTEARVQ 230
            |:.:..::.::...:...:..:.|..||.|::..|::.||...|||..|::|||:......:.:.
Mouse     8 GAPETKDNRSKARKRYGSRNSKPRHKFSRDELKRLKQEFAYAPYPDFTTKDELARQFQCEVSVID 72

  Fly   231 VWFSNRRARLRKQLNT--------QQVPSFAPTSTSFGATPTTSAAPAPNMGMSLYSSQSWPSSG 287
            .||.|:||||..:|.:        ::...:..|.......|..|.....:.. |:..|....|.|
Mouse    73 NWFQNKRARLAPELKSKISAMRRMRRCQDYMRTGHQDTQPPKASGEQYSSCD-SVVRSIGRQSIG 136

  Fly   288 AYENHAAYGGSVASMSPASSTSGTSSAAHSPV--------QTQAQQPGTGSEFMTSTY 337
            ..| |....|..:|..|.:.|       ..||        |.:.|:    :::.|.:|
Mouse   137 TVE-HQGAAGRESSFRPTNFT-------FPPVYEQYYMGDQLETQE----TQYFTFSY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 21/56 (38%)
Cphx1NP_780551.1 homeodomain 29..82 CDD:238039 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.