DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb and mxtx1

DIOPT Version :9

Sequence 1:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_571635.2 Gene:mxtx1 / 100149566 ZFINID:ZDB-GENE-000710-7 Length:309 Species:Danio rerio


Alignment Length:258 Identity:67/258 - (25%)
Similarity:95/258 - (36%) Gaps:96/258 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSNDQIDALERIFARTQYPDVYTREELAQSTGLT 225
            |:|:|.               :...||.||:||.:.::.|...|....||.:..||.|:|:|||.
Zfish    15 GSGAVS---------------RSASRRKRTSFSKEHVELLRATFETDPYPGISLRESLSQTTGLP 64

  Fly   226 EARVQVWFSNRRARL------RKQLNTQQVPSFAPTST-----------SFGATPTTSAAP---- 269
            |:|:||||.|||||.      :|.|....:|::....|           |.|||.|..:.|    
Zfish    65 ESRIQVWFQNRRARTLKCKGGKKPLWQTDLPAYNNMQTSPMQIHRKNNESSGATGTLCSPPPAYP 129

  Fly   270 ----------------APNMGMSL-----YSSQSWPSSGAYENHAAYGGSVASMSPASSTS---- 309
                            .|: .||:     |.:.|:..|.|.::|         |||:...|    
Zfish   130 DRIKEEMEKDAVCGCDTPS-SMSISDDSGYCTPSYHQSRAIQSH---------MSPSPLLSPEHQ 184

  Fly   310 -----GTSSAAHSPVQTQAQQPGTGSEFMTSTYGVGSSNATYPSAAYS--------MPQTPAT 359
                 |......||:.:           |.|.|.: .:.|..|...||        .|.||.|
Zfish   185 MPPNWGVRYGRRSPMSS-----------MWSPYHL-EAYACNPGFFYSHSEKHNTLQPLTPVT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsbNP_523863.1 PAX 19..143 CDD:128645
homeodomain 186..243 CDD:238039 28/62 (45%)
mxtx1NP_571635.2 HOX 24..78 CDD:197696 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.