DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and MIXL1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001269331.1 Gene:MIXL1 / 83881 HGNCID:13363 Length:240 Species:Homo sapiens


Alignment Length:156 Identity:57/156 - (36%)
Similarity:68/156 - (43%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EIREKLIKEGFADP------------PSTSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDISD 169
            |.|.....||.|.|            |..|..:.||.....|....    |..|.||........
Human     5 ESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA----TFAGFLGRDPGPAPP 65

  Fly   170 TESEPGIPLKRK--------QRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARI 226
            ..:..|.|...|        |||.||:|:||||:.||..|.||:|||::.||.||..|.|.|:||
Human    66 PPASLGSPAPPKGAAAPSASQRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRI 130

  Fly   227 --------QVWFSNRRARLRKHSGGS 244
                    ||||.||||:.|:.||.|
Human   131 QLLFSPLFQVWFQNRRAKSRRQSGKS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 9/35 (26%)
Homeobox 185..238 CDD:278475 32/60 (53%)
MIXL1NP_001269331.1 Homeobox 89..150 CDD:278475 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.