DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and Pax4

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_113987.1 Gene:Pax4 / 83630 RGDID:620433 Length:349 Species:Rattus norvegicus


Alignment Length:250 Identity:111/250 - (44%)
Similarity:148/250 - (59%) Gaps:20/250 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRP 84
            |...||||||:|:||||||...|.:||::|..|:|||.|||.|:||:|||||||.||..||.:.|
  Rat     5 GLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGRYYRTGVLEP 69

  Fly    85 GVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFA---DPPSTSSISRLLRGSDRG 146
            ..||||||::.:|.:..||.:|:.|.|::|:|||:.:|..||..   ..||.|||:|:||..   
  Rat    70 KGIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQRQLCAEGLCTQDKAPSVSSINRVLRAL--- 131

  Fly   147 SEDGRKDYT---INGILG-GRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYP 207
            .||.|..:|   ...:|. ...|..|:.|:..| |......|:||.|:..|.||||:.|.|.|||
  Rat   132 QEDQRLHWTQLRSPAVLAPALPSPHSNCEAPRG-PHPGTSHRNRTIFSPGQAEALEKEFQRGQYP 195

  Fly   208 DVYTREELAQTTALTEARIQVWFSNRRARLRKHS---------GGSNSGLSPMNS 253
            |...|.:||..|:|.|..::||||||||:.|:..         |.|...:.|.:|
  Rat   196 DSVVRGKLAAATSLPEDTVRVWFSNRRAKWRRQEKLKWETQMPGASQDLMVPKDS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 65/123 (53%)
Homeobox 185..238 CDD:278475 28/52 (54%)
Pax4NP_113987.1 PAX 5..129 CDD:128645 65/123 (53%)
PAI subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 8..64 36/55 (65%)
RED subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU00381 83..131 20/47 (43%)
Homeobox 174..226 CDD:278475 28/51 (55%)
Transcription repression 278..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.