DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and HAT1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_193476.1 Gene:HAT1 / 827457 AraportID:AT4G17460 Length:282 Species:Arabidopsis thaliana


Alignment Length:123 Identity:38/123 - (30%)
Similarity:54/123 - (43%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 GFADPPSTSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDI----------SDTESEPGIPLKR 180
            |.:.|.||  ||..:.|..|.:|   ::.|..|..|. |.||          ||.|.:.|....|
plant    76 GVSSPNST--ISSTVSGKRRSTE---REGTSGGGCGD-DLDITLDRSSSRGTSDEEEDYGGETCR 134

  Fly   181 KQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLR 238
            |:.|    .:.:|...||..|......:...:..||:...||..:::|||.|||||.:
plant   135 KKLR----LSKDQSAVLEDTFKEHNTLNPKQKLALAKKLGLTARQVEVWFQNRRARTK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 6/14 (43%)
Homeobox 185..238 CDD:278475 16/52 (31%)
HAT1NP_193476.1 HD-ZIP_N 8..98 CDD:282474 9/26 (35%)
HOX 134..188 CDD:197696 19/57 (33%)
HALZ 190..233 CDD:128634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.