DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax2

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001037888.1 Gene:pax2 / 733478 XenbaseID:XB-GENE-486801 Length:140 Species:Xenopus tropicalis


Alignment Length:140 Identity:85/140 - (60%)
Similarity:106/140 - (75%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDMSSANSLRPLFAGYPFQGQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVS 65
            |||..  ...|..|.:|  |.|.||||||||:||||||:.:|.:|||:|..|||||.||||||||
 Frog     1 MDMHC--KADPFSAMHP--GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVS 61

  Fly    66 HGCVSKILNRYQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFAD- 129
            ||||||||.||.|||||:|||||||||||.:|::..:|.|.:::||::|:||||::|:.||..| 
 Frog    62 HGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGICDN 126

  Fly   130 --PPSTSSIS 137
              .||.|||:
 Frog   127 DTVPSVSSIN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 79/121 (65%)
Homeobox 185..238 CDD:278475
pax2NP_001037888.1 PAX 16..137 CDD:128645 79/121 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.