DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax6b

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_005168876.1 Gene:pax6b / 60639 ZFINID:ZDB-GENE-001031-1 Length:450 Species:Danio rerio


Alignment Length:342 Identity:146/342 - (42%)
Similarity:182/342 - (53%) Gaps:76/342 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLR-------------VSHGCVSKILNR 75
            ||||||||:||||||:..|.||||:|.||.|||.|||.|:             ||:|||||||.|
Zfish    27 VNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDDAKVQLDNKNVSNGCVSKILGR 91

  Fly    76 YQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFA---DPPSTSSIS 137
            |.|||||||..||||||:|.:||:..:|.:.::|.||||:||||::|:.||..   :.||.|||:
Zfish    92 YYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSIN 156

  Fly   138 RLLRG----SDRGSEDGRKD--YTINGILG----------------------------------- 161
            |:||.    ..:...||..|  ..:||..|                                   
Zfish   157 RVLRNLASEKQQMGADGMYDKLRMLNGQSGTWGTRPGWYPGTSVPGQPNQDGCQQQDNGGENTNS 221

  Fly   162 ----GRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALT 222
                |.|||    |::..:.||||.:|:||:||.||:||||:.|.||.||||:.||.||....|.
Zfish   222 ISSNGEDSD----ETQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLP 282

  Fly   223 EARIQVWFSNRRARLRKHS-------GGSNSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGS 280
            |||||||||||||:.|:..       ..|||......|.|.|..|...:...|.|:.:   ..||
Zfish   283 EARIQVWFSNRRAKWRREEKLRNQRRQASNSSSHIPISSSFNTSVYQAIPQPTTPVSF---TTGS 344

  Fly   281 MAGYSPAPGTTATGAGM 297
            |.| .|....|.|..|:
Zfish   345 MLG-RPDTALTNTYTGL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 75/132 (57%)
Homeobox 185..238 CDD:278475 35/52 (67%)
pax6bXP_005168876.1 PAX 23..160 CDD:128645 75/132 (57%)
Homeobox 246..298 CDD:306543 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.