DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax2b

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_571715.1 Gene:pax2b / 60638 ZFINID:ZDB-GENE-001030-4 Length:386 Species:Danio rerio


Alignment Length:408 Identity:146/408 - (35%)
Similarity:195/408 - (47%) Gaps:115/408 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PFQG---QGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQE 78
            ||..   .|.||||||||:||||||:.:|.:|||:|..|||||.||||||||||||||||.||.|
Zfish     9 PFSAMHRHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYE 73

  Fly    79 TGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFAD---PPSTSSISRLL 140
            ||||:|||||||||||.:|::..:|.:.:::||::|:||||::|:.||..|   .||.|||:|::
Zfish    74 TGSIKPGVIGGSKPKVATPKVVDKIADYKRQNPTMFAWEIRDRLLAEGICDNDTVPSVSSINRII 138

  Fly   141 RGS------------------------------DRGSEDGRKDYTINGILG---------GRDSD 166
            |..                              ...|.|....|:||||||         .||:|
Zfish   139 RTKVQQPFHPSPDGTSLSTPGHTIIPSTASPPVSSSSNDPVGSYSINGILGIPRSNGEKRKRDAD 203

  Fly   167 ISD-----TESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARI 226
            .|:     ::|:..:...||..|: ..||.:|||||:|.|.|..:|||:...|..:....:|..:
Zfish   204 GSEGSAQSSDSQGSVESLRKHLRA-DAFTQQQLEALDRVFERPAFPDVFPTSEHIKPEQASEYSL 267

  Fly   227 QVWFSNRRARLRKHSGGSNSGL-----SPMNSGSSNVG--------VGVGLSGATAPLGY----G 274
            .               ..|:||     |..:|.:|::|        ||..::..|.| ||    .
Zfish   268 P---------------ALNTGLDEVKPSLSSSAASDLGASVSQSYPVGRDMANTTLP-GYPPHVP 316

  Fly   275 PLGVGSMAGYSPAPGTTATGAGMNDGVHHAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQH 339
            |.|.||.        .|:|.|||..|...:.: |.||....|...|..                 
Zfish   317 PTGQGSY--------PTSTLAGMVPGSEFSGN-PYSHPQYTTYNEAWR----------------- 355

  Fly   340 GFPGGFAQPGHFGSQNYY 357
                 |:.|....|..||
Zfish   356 -----FSNPAILSSPYYY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 78/126 (62%)
Homeobox 185..238 CDD:278475 15/52 (29%)
pax2bNP_571715.1 PAX 15..139 CDD:128645 78/123 (63%)
Pax2_C 290..384 CDD:289189 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.