DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax4

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001232009.2 Gene:pax4 / 561564 ZFINID:ZDB-GENE-041210-244 Length:360 Species:Danio rerio


Alignment Length:304 Identity:118/304 - (38%)
Similarity:174/304 - (57%) Gaps:36/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FQGQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSI 82
            |.|:|.||||||||:||||||.:.|..::|:|..|:|||.|||.|:||:|||||||.|:|.||:|
Zfish    13 FSGEGSVNQLGGVFLNGRPLPVYKRRLMIELATEGMRPCEISRILKVSNGCVSKILGRFQRTGAI 77

  Fly    83 RPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFA---DPPSTSSISRLLRGSD 144
            .|..:|||:|::.:||:.:.|.:.:::||::|:||||:||..|...   ..||.|||:|:|:...
Zfish    78 GPKAVGGSRPRLLTPEVISIIVQHKRQNPTLFAWEIRQKLATERACRGDQVPSVSSINRILKKIH 142

  Fly   145 RGSE---DGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQY 206
            :..:   ...|.|....:     :..|..:.:....|:|...||||.|||:|...||:.|:...|
Zfish   143 QDVDIAYPNEKHYHTEHL-----NVQSHFQQQMNTNLRRTAHRSRTAFTADQSGRLEKEFTCGLY 202

  Fly   207 PDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMNSGSSNVGVGVGLSGATAPL 271
            ||:.|||:||:.|.|::..|:|||||||||:|:.....::            ..|:...|.....
Zfish   203 PDLLTREKLAEETNLSQDTIKVWFSNRRARMRRERKFEHN------------DCGIARRGFLGNC 255

  Fly   272 GYGPLGVGSMAGYSPAPGTTATGAGMNDGVHHAAHAPSSHHSAA 315
            ....:.:.|.||.|           ::|  :.|.||||:...||
Zfish   256 RNALISLSSTAGCS-----------LDD--YRAHHAPSAFPLAA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 65/123 (53%)
Homeobox 185..238 CDD:278475 30/52 (58%)
pax4NP_001232009.2 PAX 15..139 CDD:128645 65/123 (53%)
HOX 180..228 CDD:197696 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.