DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and PAX7

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_002575.1 Gene:PAX7 / 5081 HGNCID:8621 Length:520 Species:Homo sapiens


Alignment Length:452 Identity:210/452 - (46%)
Similarity:259/452 - (57%) Gaps:87/452 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GYPFQ-----GQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILN 74
            |:|.:     |||||||||||||||||||||||.||||||..|:||||||||||||||||||||.
Human    24 GFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILC 88

  Fly    75 RYQETGSIRPGVIGGSKPK-VTSPEIETRIDELRKENPSIFSWEIREKLIKEGFAD---PPS--T 133
            |||||||||||.||||||: |.:|::|.:|:|.::|||.:||||||::|:|:|..|   .||  .
Human    89 RYQETGSIRPGAIGGSKPRQVATPDVEKKIEEYKRENPGMFSWEIRDRLLKDGHCDRSTVPSGLV 153

  Fly   134 SSISRLLR----------GSDRGSEDGRK--DYTINGILGGRDSDI---SDTESEPGIPLKRKQR 183
            |||||:||          .:|:..:||.|  .::|:||||.:.:.:   ||.||||.:|||||||
Human   154 SSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRKQR 218

  Fly   184 RSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGL 248
            ||||||||||||.||:||.||.|||:||||||||.|.|||||:||||||||||.||.:|.:.  |
Human   219 RSRTTFTAEQLEELEKAFERTHYPDIYTREELAQRTKLTEARVQVWFSNRRARWRKQAGANQ--L 281

  Fly   249 SPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATGAGMNDG---VHHAAH-APS 309
            :..|.              ..|.|:.|.|:.::..|.....|..|.....||   ||.... .||
Human   282 AAFNH--------------LLPGGFPPTGMPTLPPYQLPDSTYPTTTISQDGGSTVHRPQPLPPS 332

  Fly   310 SHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPGHFGSQNYYHQDYSKLTIDDFSKLTA 374
            :.|....|||||...|. ..|     .|:|.|                 ..||    |.|     
Human   333 TMHQGGLAAAAAAADTS-SAY-----GARHSF-----------------SSYS----DSF----- 365

  Fly   375 DSVSKISPSLHLSDNYSKLEAPSNWSQAAYHAAANYNAHVAQHQLNDYAAAAAHGNPASAYS 436
              ::..:||.|::      ...:..|........|.:|...|.|. |::.:..||...||.|
Human   366 --MNPAAPSNHMN------PVSNGLSPQVMSILGNPSAVPPQPQA-DFSISPLHGGLDSATS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 92/126 (73%)
Homeobox 185..238 CDD:278475 44/52 (85%)
PAX7NP_002575.1 paired box domain 34..164 94/129 (73%)
PAX 34..163 CDD:238076 94/128 (73%)
octapeptide 86..93 5/6 (83%)
paired homeodomain 217..275 48/57 (84%)
Homeobox 220..273 CDD:278475 44/52 (85%)
Pax7 347..385 CDD:289156 13/77 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126858at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - mtm8597
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45636
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4594
SonicParanoid 1 1.000 - - X1205
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.