DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and PAX6

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001355839.1 Gene:PAX6 / 5080 HGNCID:8620 Length:503 Species:Homo sapiens


Alignment Length:412 Identity:156/412 - (37%)
Similarity:199/412 - (48%) Gaps:97/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRP 84
            |...||||||||:||||||:..|.||||:|.||.|||.|||.|:||:|||||||.||.|||||||
Human    85 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRP 149

  Fly    85 GVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFA---DPPSTSSISRLLRG---- 142
            ..||||||:|.:||:.::|.:.::|.||||:||||::|:.||..   :.||.|||:|:||.    
Human   150 RAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLASE 214

  Fly   143 SDRGSEDGRKD--YTINGILG---------------------------------------GRDSD 166
            ..:...||..|  ..:||..|                                       |.|||
Human   215 KQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQEGGGENTNSISSNGEDSD 279

  Fly   167 ISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFS 231
                |::..:.||||.:|:||:||.||:||||:.|.||.||||:.||.||....|.|||||||||
Human   280 ----EAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFS 340

  Fly   232 NRRARLRKHSGGSNSGLSPMN-------SGSSNVGVGVGLSGATAPLGYGPLGVGSMAG------ 283
            ||||:.|:.....|......|       |.|.:..|...:...|.|:  .....|||.|      
Human   341 NRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQPIPQPTTPV--SSFTSGSMLGRTDTAL 403

  Fly   284 ---YS------------------PAPGTTATGAGMNDGVHHAAHAPSSHHSAATAAAAAHHHTQM 327
               ||                  |.|..|::.:.|      ...:||.:..:.......|..|.|
Human   404 TNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCM------LPTSPSVNGRSYDTYTPPHMQTHM 462

  Fly   328 GGYDLVQSAAQHGFPGGFAQPG 349
            ....:..|...   ..|...||
Human   463 NSQPMGTSGTT---STGLISPG 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 76/123 (62%)
Homeobox 185..238 CDD:278475 35/52 (67%)
PAX6NP_001355839.1 PAX 85..209 CDD:128645 76/123 (62%)
Homeobox 295..348 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.