DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and gsb

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:472 Identity:227/472 - (48%)
Similarity:274/472 - (58%) Gaps:107/472 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SANSLRPLFAGYPFQGQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCV 69
            ||.::.|.|.||||||||||||||||||||||||||||.:||||||:||||||||||||||||||
  Fly     4 SALNMTPYFGGYPFQGQGRVNQLGGVFINGRPLPNHIRRQIVEMAAAGVRPCVISRQLRVSHGCV 68

  Fly    70 SKILNRYQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFAD---PP 131
            ||||||:||||||||||||||||:|.:|:||:||:||::..|.|||||||.|||:.|..|   .|
  Fly    69 SKILNRFQETGSIRPGVIGGSKPRVATPDIESRIEELKQSQPGIFSWEIRAKLIEAGVCDKQNAP 133

  Fly   132 STSSISRLLRGSDRGSEDGRKDYTINGILGG-----RDSDISDTESEPGIPLKRKQRRSRTTFTA 191
            |.||||||||||. ||   ...::|:|||||     ...|.|:.::||.:.||||||||||||:.
  Fly   134 SVSSISRLLRGSS-GS---GTSHSIDGILGGGAGSVGSEDESEDDAEPSVQLKRKQRRSRTTFSN 194

  Fly   192 EQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSG----------GSNS 246
            :|::||||.|:|||||||||||||||:|.|||||:|||||||||||||...          .::.
  Fly   195 DQIDALERIFARTQYPDVYTREELAQSTGLTEARVQVWFSNRRARLRKQLNTQQVPSFAPTSTSF 259

  Fly   247 GLSPMNSGSSNVGVGVGL--------SGA-TAPLGYGPLGVGSMAGYSPAPGTTATGAGMNDGVH 302
            |.:|..|.:....:|:.|        ||| .....||    ||:|..|||..|:.|.:       
  Fly   260 GATPTTSAAPAPNMGMSLYSSQSWPSSGAYENHAAYG----GSVASMSPASSTSGTSS------- 313

  Fly   303 HAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPG----------HFGSQN-- 355
             |||:|                        ||:.||        |||          ..||.|  
  Fly   314 -AAHSP------------------------VQTQAQ--------QPGTGSEFMTSTYGVGSSNAT 345

  Fly   356 YYHQDYSKLTIDDFSKLTADSVSKISPSLHLSDNYSKLEAPSNWSQAAYHAAANYNAHVAQHQLN 420
            |....||      ..:..|.|..::. |...|...|....||.|.  :|:.|.::          
  Fly   346 YPSAAYS------MPQTPATSAEQLR-SQFASAAASGSHHPSTWD--SYNFAGSF---------- 391

  Fly   421 DYAAAAAHGNPASAYSH 437
             :..|:|.||..|.|.|
  Fly   392 -FPPASAAGNHISGYHH 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 98/123 (80%)
Homeobox 185..238 CDD:278475 42/52 (81%)
gsbNP_523863.1 PAX 19..143 CDD:128645 98/123 (80%)
homeodomain 186..243 CDD:238039 46/56 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469590
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 1 0.900 - - E1_KOG0849
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 385 1.000 Inparanoid score I4121
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126858at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - mtm6578
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1205
109.900

Return to query results.
Submit another query.