DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and otp

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:332 Identity:94/332 - (28%)
Similarity:135/332 - (40%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SRLLRGSDRGSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAF 201
            |..|.|.:..|.:|..    |...|..:::.|..:.:..:. |.||:|.||.||..||..|||.|
  Fly    76 SNALNGGNGSSGNGNG----NNNNGNGNNNNSMQQQDQHLD-KNKQKRHRTRFTPAQLNELERCF 135

  Fly   202 SRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSN-----------SGLSPMNSGS 255
            |:|.|||::.|||:|....|||:|:||||.||||:.:|....:|           .||.|..:..
  Fly   136 SKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRTPGALLPSHGLPPFGANI 200

  Fly   256 SNVGVGVGLSGATA------PLGYGPL--GVGSMAGYSPAPGTTATGAGMNDGVH--HAAHAPSS 310
            :|:.:|.||.|...      .:|..|:  |.|.:...||.  :::..:|:|.|::  .|..|.|.
  Fly   201 TNIAMGDGLCGTGMFGGDRWSVGVNPMTAGFGQLNQSSPL--SSSLNSGLNSGINMGSALGAGSY 263

  Fly   311 HHSAATAA--AAAHHHTQMGGYDLVQSAAQHGFPGGFAQPGHFGSQNYYHQDYSKLTIDDFSKLT 373
            .|....|.  :..:.|: :||.    |....|.|.....|                        .
  Fly   264 QHYGLNALGDSMMYQHS-VGGV----SCGPSGSPSATTPP------------------------N 299

  Fly   374 ADSVSKIS-PSLHLSDNYSKLEAPSNWSQAAYHAAANYNAHVAQHQLNDYAAAAAHGNPASAYSH 437
            .:|.|.:: |.|....|.|:.|.  |......|.......|  |||...     .|.:...|  .
  Fly   300 MNSCSSVTPPPLSAQPNSSQNEL--NGEPMPLHQQQQQQTH--QHQQQQ-----THQHHPMA--P 353

  Fly   438 PLPTQGQ 444
            |.|||.|
  Fly   354 PTPTQQQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 1/3 (33%)
Homeobox 185..238 CDD:278475 31/52 (60%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450944
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.