DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and Poxn

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster


Alignment Length:459 Identity:136/459 - (29%)
Similarity:182/459 - (39%) Gaps:145/459 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PFQGQGRVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGS 81
            |..||..||||||||:||||||:.:|.:||::|..|||||.|||||.||||||||||.|:.||||
  Fly     2 PHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGS 66

  Fly    82 IRPGVIGGSKPK-VTSPEIETRIDELRKENPSIFSWEIREKLIKEGFADP---PSTSSISRLLRG 142
            ||||.|||||.| |.:|.:..:|..|::||..:|:|||||:|.::...||   ||.|||:|:||.
  Fly    67 IRPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRN 131

  Fly   143 SDRGSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYP 207
            |...:::                                       .|:.|..|...|.:     
  Fly   132 SGLWTDE---------------------------------------MTSSQQNAAAAAAA----- 152

  Fly   208 DVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMNSGSSNVGVGVGLSGATAPLG 272
                                       |....|..|         ||.||   |.|......|:.
  Fly   153 ---------------------------AAAAAHQAG---------SGPSN---GYGGQAPPPPVT 178

  Fly   273 YG---PLGVGSMAGYSPAPGTTATGAG-------------MNDGVHHAAHAPSSHHSAATAAAAA 321
            ..   |....|:|.|:..|......||             |..|..|..:...|....:.:|...
  Fly   179 VAPPTPAATPSIARYAKPPALMMNSAGEMPIKPAPKMPPSMGHGHSHGLNPNVSGLDLSYSALHK 243

  Fly   322 H--------HHTQMGGYDLVQSAAQHG----FPGGF---AQPGHFGSQNYYHQDYSKLTIDDFSK 371
            |        ::||  .:...|:||..|    :.||:   |......|        |...:..|:|
  Fly   244 HWLWNPSLLYYTQ--AHIQAQAAASGGQFLPYAGGYLPHAMAAAAAS--------STSALGGFTK 298

  Fly   372 LTADSVSKISPSL---HLSDNYSKLEAPSNWSQAAYHAAANYNAHVAQHQLNDYAAAAAHGNPAS 433
             :..|:...:|..   .|||..|...:|:..|..   |:...|.          |.:|...:|.|
  Fly   299 -SESSIDLSTPGAAGDALSDCDSGKSSPAALSLT---ASGGGNG----------AGSAPEASPGS 349

  Fly   434 AYSH 437
            ..||
  Fly   350 TLSH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 76/124 (61%)
Homeobox 185..238 CDD:278475 5/52 (10%)
PoxnNP_001261016.1 HTH 5..133 CDD:304362 78/127 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.