DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and eve

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:324 Identity:78/324 - (24%)
Similarity:106/324 - (32%) Gaps:111/324 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PPS----TSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRTTFT 190
            |||    .||....|.|| ||||                           ||.....||.||.||
  Fly    42 PPSPNECLSSPDNSLNGS-RGSE---------------------------IPADPSVRRYRTAFT 78

  Fly   191 AEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMNSGS 255
            .:||..||:.|.:..|.....|.|||....|.|:.|:|||.|||.:.::..              
  Fly    79 RDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR-------------- 129

  Fly   256 SNVGVGVGLSGATAPLGYGPLGVGSMAGYS-PAPGTTATGAGMND-GVHHAAHAPSSHHSAATAA 318
                :.|....|              |.|| ||...:...|..|. |:.:..:||::..:||.||
  Fly   130 ----IAVAWPYA--------------AVYSDPAFAASILQAAANSVGMPYPPYAPAAAAAAAAAA 176

  Fly   319 AAAHHHTQMGGYDLVQSAAQHGFPGGFAQ------PGHFGSQNYYHQDYSKLTIDDFSKLTADSV 377
            |.|.:.....|..          |.|..|      |||.|...:                     
  Fly   177 AVATNPMMATGMP----------PMGMPQMPTMQMPGHSGHAGH--------------------- 210

  Fly   378 SKISPSLHLSDNYSKLEAPSNWSQAAYHAAANYNAHVAQHQLNDYAAAAAHGNPASAYSHPLPT 441
                ||.:....|:....|:.  .|..|.|..:..|  .|.:...|..:::...|:.....||:
  Fly   211 ----PSPYGQYRYTPYHIPAR--PAPPHPAGPHMHH--PHMMGSSATGSSYSAGAAGLLGALPS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 5/14 (36%)
Homeobox 185..238 CDD:278475 23/52 (44%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450992
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.