DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and CG11294

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:263 Identity:86/263 - (32%)
Similarity:115/263 - (43%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGG 243
            :|:|||:|||||.:||:.||..|.:|.||||:.|||:|...:|:|||:||||.||||:.||.:..
  Fly    21 RRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQARL 85

  Fly   244 S-----------NSGLSPMNSGSSNVGVGVGLSGATA-PLGYGPLGVGSMAGYSPAPGTTATGAG 296
            .           :.|..|:..|.:..| |.| :|||| |....|..:.|.:..|.   ....|.|
  Fly    86 QLLQDAWRMRCLSLGTPPVMGGGAVQG-GSG-NGATARPPSQTPENLSSASKDSE---LAEVGNG 145

  Fly   297 MNDG----VH------HAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFP-GGFAQ-PG 349
            .|.|    :|      |.......|..|......:..:|::..|    .|..||.. ||.|. .|
  Fly   146 PNSGSFTMMHPAFQQQHQQQQHQGHQQATDQDKLSKTYTELKLY----KAPSHGMELGGMAALSG 206

  Fly   350 HF--GSQNYYHQDYSKLTIDDFSKLTADSVSKISPSLHLSDNYSKLEAPSNWSQ------AAYHA 406
            |.  ||.....::     ||    ||:.:....|.|       |||:......|      ||..|
  Fly   207 HSDEGSDGSDSEE-----ID----LTSGACIDFSQS-------SKLQQQQQQQQQQGTQGAAGSA 255

  Fly   407 AAN 409
            .||
  Fly   256 EAN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 31/52 (60%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 30/50 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450984
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.