DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and Dux4

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006252740.1 Gene:Dux4 / 306226 RGDID:1311053 Length:357 Species:Rattus norvegicus


Alignment Length:219 Identity:57/219 - (26%)
Similarity:82/219 - (37%) Gaps:65/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 SDTESEPG--IPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWF 230
            |:...|.|  .|..::..||||.||..|::.|..||.:.::|.:.|||:|||.|.:.|:||.:||
  Rat    78 SEESQEQGQDKPRVKEAGRSRTHFTKFQIDILIEAFEKNRFPGIVTREKLAQETGIPESRIHIWF 142

  Fly   231 SNRRARLRKHSGGSNS-----------------GLSPMNSGSSNVGVGVGLSGATAPLGYGPLGV 278
            .|||||......|:.:                 .|:|....:|:..|.:.||....|  .|||.:
  Rat   143 QNRRARHPDPKQGTRATSHPPESSQCPAQKTTGQLAPSKDPTSSCSVILPLSPPHTP--NGPLDL 205

  Fly   279 GSMAGYSPAPGTT--------------------------ATGAGMNDGVHHAA----------HA 307
             |.......|.||                          ....|..:|.|..|          |.
  Rat   206 -SRGRQKQLPETTVLQPSQVVQRRGDDQNPSLFIDHLSEVKSPGEKEGFHTQAPLQLPIQKRGHN 269

  Fly   308 PSSHHSA-------ATAAAAAHHH 324
            ||.:...       :|..:|.:.|
  Rat   270 PSENSGLSVPPLEDSTQVSAVNQH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 27/52 (52%)
Dux4XP_006252740.1 homeodomain 15..71 CDD:238039
Homeobox 97..149 CDD:278475 26/51 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.