Sequence 1: | NP_523862.1 | Gene: | gsb-n / 38004 | FlyBaseID: | FBgn0001147 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006252740.1 | Gene: | Dux4 / 306226 | RGDID: | 1311053 | Length: | 357 | Species: | Rattus norvegicus |
Alignment Length: | 219 | Identity: | 57/219 - (26%) |
---|---|---|---|
Similarity: | 82/219 - (37%) | Gaps: | 65/219 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 SDTESEPG--IPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWF 230
Fly 231 SNRRARLRKHSGGSNS-----------------GLSPMNSGSSNVGVGVGLSGATAPLGYGPLGV 278
Fly 279 GSMAGYSPAPGTT--------------------------ATGAGMNDGVHHAA----------HA 307
Fly 308 PSSHHSA-------ATAAAAAHHH 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gsb-n | NP_523862.1 | PAX | 20..141 | CDD:278709 | |
Homeobox | 185..238 | CDD:278475 | 27/52 (52%) | ||
Dux4 | XP_006252740.1 | homeodomain | 15..71 | CDD:238039 | |
Homeobox | 97..149 | CDD:278475 | 26/51 (51%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0849 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |