DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and msx3

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_571347.2 Gene:msx3 / 30526 ZFINID:ZDB-GENE-980526-306 Length:273 Species:Danio rerio


Alignment Length:254 Identity:65/254 - (25%)
Similarity:92/254 - (36%) Gaps:74/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VSHGCVSKILNRYQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFA 128
            :|....|:.|....|.|.|.|               .:..||..|.:|...            :|
Zfish    57 ISDRTSSRTLYTSSEAGIISP---------------TSGADERLKLSPMAL------------YA 94

  Fly   129 D----PPSTSSISRLLRG-----SDRGSEDGRKDYTINGILGGRDSDISDT-----ESEPGIPLK 179
            |    ..|.|::|...||     ||:|.             .|.....|.|     .|.|...|:
Zfish    95 DRKIPVESVSNLSDCKRGDMEELSDKGQ-------------SGWFQTTSYTSPPRHSSPPPCTLR 146

  Fly   180 --RKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSG 242
              :..|:.||.||..||.||||.|.:.||..:..|.|.:.:..|||.::::||.||||:.::...
Zfish   147 KHKNNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSNSLNLTETQVKIWFQNRRAKAKRLQE 211

  Fly   243 G-------SNSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATG 294
            .       :...|.|..:....:|..||    :.|| |||      :...|.|.....|
Zfish   212 AELEKLKLATKPLLPAFAFPFPLGTHVG----SPPL-YGP------SSSFPRPALPVPG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 16/80 (20%)
Homeobox 185..238 CDD:278475 24/52 (46%)
msx3NP_571347.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..159 12/57 (21%)
Homeobox 154..207 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.