DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and mixl1

DIOPT Version :10

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_571015.3 Gene:mixl1 / 30115 ZFINID:ZDB-GENE-000208-20 Length:327 Species:Danio rerio


Alignment Length:76 Identity:36/76 - (47%)
Similarity:49/76 - (64%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 RRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSG 247
            ||.||.||.:|::.||:.:..|:|||:|.||:|...|.|.|:||||||.||||:.|:     ..|
Zfish    59 RRKRTNFTQQQIDVLEKVYLDTKYPDIYLREKLEALTGLPESRIQVWFQNRRAKSRR-----QVG 118

  Fly   248 LSPMNSGSSNV 258
            :|..|..|.|:
Zfish   119 ISIPNKTSGNI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 HTH_CRP 20..141 CDD:481199
Homeodomain 183..239 CDD:459649 30/55 (55%)
mixl1NP_571015.3 Homeodomain 59..115 CDD:459649 30/55 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.