DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and Mixl1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:338 Identity:84/338 - (24%)
Similarity:116/338 - (34%) Gaps:134/338 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGG---------SKPKVTSPEIETRI 103
            |||:|      |:||:.:.|............|.:.|.....         |:....:|...:|.
  Rat     1 MAAAG------SQQLQFAEGAAFPTFPAAHPGGQLLPAARPATGLPPAPPDSRAPAATPCFPSRG 59

  Fly   104 DELRKENPSIFSWEIREKLIKEGFADPPSTSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDIS 168
            .....:.|:             |. |||          |..:||                     
  Rat    60 PRPAAQTPT-------------GL-DPP----------GPSKGS--------------------- 79

  Fly   169 DTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNR 233
               :.|..|    |||.||:|::|||:.||..|.:|.|||::.||.||..|.|.|:||||||.||
  Rat    80 ---AAPSAP----QRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNR 137

  Fly   234 RARLRKHSGGSNSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTA----TG 294
            ||:.|:.||.|   ..|::|...:.                        .:.|||||.|    ..
  Rat   138 RAKSRRQSGKS---FQPLSSRREDF------------------------LHRPAPGTEARCLKPQ 175

  Fly   295 AGMNDGVHHAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPGHFGSQNYYHQ 359
            ..:...|:|..                  .:.|.|             ||....   |||.:  :
  Rat   176 LPLEADVNHVL------------------DSSMAG-------------GGVCTS---GSQGF--E 204

  Fly   360 DYSKLTIDDFSKL 372
            .||.|:.|..|||
  Rat   205 TYSSLSEDIGSKL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 18/101 (18%)
Homeobox 185..238 CDD:278475 30/52 (58%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 53/194 (27%)
Homeobox 89..143 CDD:395001 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.