DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and sebox

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:273 Identity:68/273 - (24%)
Similarity:100/273 - (36%) Gaps:90/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 KQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSN 245
            :::|.||.|:..||..|||||..|.|||:..||.||..|.|.|::|||||.|||||..|    |.
Zfish    57 QRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARSMK----SK 117

  Fly   246 SGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATGAGMNDGVHHAAHAPSS 310
            ..::|::.                              .|||          .|....|.|...:
Zfish   118 KLITPVSR------------------------------RSPA----------KDCTFPATHPDLN 142

  Fly   311 HHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPGHFGSQNYYHQDYSKLTIDDFSKLTAD 375
            ...:..|..:..||.|    .|::.|.                 |.:.|:...::.|        
Zfish   143 LEQSPEANKSLRHHQQ----SLIRQAL-----------------NPWPQNRPPISPD-------- 178

  Fly   376 SVSKISPSLHLSDNYSKLEAPSNW----SQAAYHAAANYNAHVAQHQLNDYAAAAAHGNPASAYS 436
                :...|..::..|:....|::    |:...|...|.::.|  .|:|.:   |||.....:|.
Zfish   179 ----LPEILQWANRNSETPGDSSFSSCPSERIQHPFPNQSSSV--WQMNCF---AAHPEGLKSYC 234

  Fly   437 HPLPTQGQAKYWS 449
                |..||.|.|
Zfish   235 ----TTSQALYSS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 31/52 (60%)
seboxNP_001306981.1 COG5576 13..159 CDD:227863 45/149 (30%)
Homeobox 61..112 CDD:278475 29/50 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 7/66 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.