DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and Duxbl1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_899245.1 Gene:Duxbl1 / 278672 MGIID:1916048 Length:350 Species:Mus musculus


Alignment Length:291 Identity:83/291 - (28%)
Similarity:115/291 - (39%) Gaps:53/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRA 235
            |.|...|..::.|||||.||..|.:.|..||.:.::|.:.|||:|||.|.:.|:||.:||.||||
Mouse    83 EQEQDKPRVKEARRSRTHFTKFQTDILIEAFEKNRFPGIVTREKLAQQTGIPESRIHIWFQNRRA 147

  Fly   236 R---------LRKHSGGSNSG--------LSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAG 283
            |         ...|...|:.|        |:|..:.:|:..|.:.||....|  .|||.: |...
Mouse   148 RHPDPGQNTQKTPHPPQSSQGPTQKTVGKLAPSKTLTSSASVILPLSPPHTP--NGPLDL-SKGR 209

  Fly   284 YSPAPGTTATGAGMNDGVHHAAHAPSSHH-SAATAAAAAHHHTQMGGYDLVQSAAQHGFP---GG 344
            ....||||...:............|:..| |..|.......|:|.....|.|:...:  |   ||
Mouse   210 QKQLPGTTLLQSSQVVQQRSDDQNPNKGHLSPTTTPGEQGFHSQPPLQLLTQNRGHN--PRESGG 272

  Fly   345 FAQPGHFGSQNY--YHQDYSKLTIDDFSKLTADSVSKISPSLHLSDNYSKLEA---PSN--WSQA 402
            .|.|........  .:|.:.||..:|.|.|.           |..:.:..:.|   |..  ||:.
Mouse   273 LAVPRLEDCTQVPAVNQHFRKLDQNDSSFLQ-----------HWDEWFGSMLAEWMPDKEYWSEK 326

  Fly   403 AYHAAANYNAHVAQHQLNDYAAAA--AHGNP 431
            |       ..|..|.||...|:.:  ||..|
Mouse   327 A-------ELHPWQVQLRQLASVSPQAHQTP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 27/61 (44%)
Duxbl1NP_899245.1 homeodomain 15..71 CDD:238039
HOX 95..149 CDD:197696 28/53 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.