DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax-2

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_500513.1 Gene:pax-2 / 187062 WormBaseID:WBGene00003938 Length:351 Species:Caenorhabditis elegans


Alignment Length:121 Identity:76/121 - (62%)
Similarity:96/121 - (79%) Gaps:3/121 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIG 88
            ||||||||:||||||:.||.:||||:..|.|||.|||||:||||||||||.||..|||:||||||
 Worm    95 VNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIG 159

  Fly    89 GSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKE---GFADPPSTSSISRLLR 141
            ||||||.:|.:...|...::.||::|:||||:|||::   |..:.||.|||:|::|
 Worm   160 GSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 75/119 (63%)
Homeobox 185..238 CDD:278475
pax-2NP_500513.1 PAX 91..215 CDD:128645 75/119 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.