DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax-2

DIOPT Version :10

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_500513.1 Gene:pax-2 / 187062 WormBaseID:WBGene00003938 Length:351 Species:Caenorhabditis elegans


Alignment Length:121 Identity:76/121 - (62%)
Similarity:96/121 - (79%) Gaps:3/121 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIG 88
            ||||||||:||||||:.||.:||||:..|.|||.|||||:||||||||||.||..|||:||||||
 Worm    95 VNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIG 159

  Fly    89 GSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKE---GFADPPSTSSISRLLR 141
            ||||||.:|.:...|...::.||::|:||||:|||::   |..:.||.|||:|::|
 Worm   160 GSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEENVPSVSSINRIVR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 HTH_CRP 20..141 CDD:481199 75/119 (63%)
Homeodomain 183..239 CDD:459649
pax-2NP_500513.1 PAX 91..215 CDD:128645 75/119 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.