DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and npax-1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_495533.2 Gene:npax-1 / 184779 WormBaseID:WBGene00017664 Length:176 Species:Caenorhabditis elegans


Alignment Length:152 Identity:45/152 - (29%)
Similarity:75/152 - (49%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MSSANSLRPLFAGYPFQGQG-RVNQLGGVFINGRPLPNHIRLKIVEMAASGVRPCVISRQLRVSH 66
            :||||     .:..|...:| :|..:|..:..||||....|.|||.:...|.|...|:|.:.|:|
 Worm    43 LSSAN-----ISTSPEINEGEKVKAVGRSYNPGRPLCLEDRKKIVRLYEEGCRVSHIARLIGVTH 102

  Fly    67 GCVSKILNRYQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIFSWEIREKLIKEGFADPP 131
            .|||||::||:.|||::|.....::               .:||.:. :|: :::|.::...:.|
 Worm   103 SCVSKIMSRYRRTGSVQPRSFRATE---------------NQENDNA-TWQ-QQQLKQQQKKEKP 150

  Fly   132 STSSISRLLRGSDRGSEDGRKD 153
            ...||.|:|      |.|.:|:
 Worm   151 LPFSIERIL------SPDIKKE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 36/121 (30%)
Homeobox 185..238 CDD:278475
npax-1NP_495533.2 HTH 60..>122 CDD:389747 27/61 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.