DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and ceh-53

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_500361.3 Gene:ceh-53 / 182467 WormBaseID:WBGene00015651 Length:203 Species:Caenorhabditis elegans


Alignment Length:180 Identity:60/180 - (33%)
Similarity:83/180 - (46%) Gaps:26/180 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGG 243
            :|:.||.||.|:..|||.||.||.:.|||||..||.|.:.|.|.||||||||.||||:.||....
 Worm    28 ERRVRRLRTAFSENQLELLEEAFLKCQYPDVQQRETLGKQTELAEARIQVWFKNRRAKARKRQRN 92

  Fly   244 SNSGLSPMNSGSSNVGVGVG-----LSGATAPLGYGPLGVGSMAGYSPAPGTTA---TGAGMNDG 300
            .::........|:..|...|     ....|..:.:.|  ..::...|.:|.||:   |.|...:.
 Worm    93 ESTDSCSTTEESNEEGDADGCLKKKAKNETTIITWTP--GAALFNSSLSPTTTSIPTTPAPPLNF 155

  Fly   301 VHHA----AHAP-------SSHHSAATAAAAAHHHTQMGGYDLVQSAAQH 339
            :.|.    |:.|       .:|..|||..||:     :|...||.:...:
 Worm   156 ICHQNPFYAYNPYRNLNTIPTHLLAATTTAAS-----IGSAKLVANVGSN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 32/52 (62%)
ceh-53NP_500361.3 Homeobox 35..81 CDD:365835 28/45 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.