DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and alr-1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_509860.1 Gene:alr-1 / 181302 WormBaseID:WBGene00044330 Length:362 Species:Caenorhabditis elegans


Alignment Length:195 Identity:73/195 - (37%)
Similarity:100/195 - (51%) Gaps:45/195 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ELRKENPS----------------------IFSWEIREKLIKEGFADP-------PSTSSISRLL 140
            ||:||:.|                      .:|..:.|:|..:.||:|       |...||:.|.
 Worm     3 ELKKEDSSKDEKDLDMNCPPLHRPNGADLNQYSKSLMEQLQAQLFANPALQFPSFPPAFSIAALT 67

  Fly   141 RGS-DRGSEDGRKDYTINGIL----------GGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQL 194
            ... :...:||:|..|.:.||          .|..||.:::..:.|   ||||||.||||:|.||
 Worm    68 NNQHELKEDDGKKTPTGDNILEAASVLDNRENGSPSDGTNSPDDNG---KRKQRRYRTTFSAFQL 129

  Fly   195 EALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGS--NSGLSPMNSGSSN 257
            :.||:.|:||.||||:||||||....|||||:||||.||||:.||....|  :...:||:..:||
 Worm   130 DELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQERSSTHHPYQAPMSIPNSN 194

  Fly   258  257
             Worm   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 15/64 (23%)
Homeobox 185..238 CDD:278475 35/52 (67%)
alr-1NP_509860.1 Homeobox 121..174 CDD:365835 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.