Sequence 1: | NP_523862.1 | Gene: | gsb-n / 38004 | FlyBaseID: | FBgn0001147 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509860.1 | Gene: | alr-1 / 181302 | WormBaseID: | WBGene00044330 | Length: | 362 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 73/195 - (37%) |
---|---|---|---|
Similarity: | 100/195 - (51%) | Gaps: | 45/195 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 ELRKENPS----------------------IFSWEIREKLIKEGFADP-------PSTSSISRLL 140
Fly 141 RGS-DRGSEDGRKDYTINGIL----------GGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQL 194
Fly 195 EALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGS--NSGLSPMNSGSSN 257
Fly 258 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gsb-n | NP_523862.1 | PAX | 20..141 | CDD:278709 | 15/64 (23%) |
Homeobox | 185..238 | CDD:278475 | 35/52 (67%) | ||
alr-1 | NP_509860.1 | Homeobox | 121..174 | CDD:365835 | 35/52 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |