DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and Gsc

DIOPT Version :10

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus


Alignment Length:66 Identity:36/66 - (54%)
Similarity:47/66 - (71%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 RKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGS 244
            |::||.||.||.|||||||..|..|:||||.|||:||:...|.|.:::|||.||||:.|:....|
Mouse   158 RRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSS 222

  Fly   245 N 245
            :
Mouse   223 S 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 HTH_CRP 20..141 CDD:481199
Homeodomain 183..239 CDD:459649 33/55 (60%)
GscNP_034481.1 Homeodomain 161..217 CDD:459649 33/55 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.