DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and LOC100485335

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_002938577.1 Gene:LOC100485335 / 100485335 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:173 Identity:66/173 - (38%)
Similarity:91/173 - (52%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GSEDGRKDYTINGILGGR-----------DSDISDTESEPG------------IPLKRKQRRSRT 187
            |:...|:|:..:.|:.|:           ||.: |:|.:||            :.||||.:|:||
 Frog    18 GAWGSRQDWYQDNIVTGQSNTTIDSCQQLDSSL-DSEHQPGAANDDLDESQIRLQLKRKLQRNRT 81

  Fly   188 TFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMN 252
            :||.||:||||:.|.||.||||:.||.||....|.|||||||||||||:.|:.....|......|
 Frog    82 SFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASN 146

  Fly   253 SGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATGA 295
            : ||::.:....|.:.......|...|||.|.|.|..|.:.|:
 Frog   147 T-SSHLSINSSFSSSVYQSIPQPSNSGSMLGRSEAAITNSYGS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 35/52 (67%)
LOC100485335XP_002938577.1 Homeobox 80..133 CDD:365835 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.