DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and arxb

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:388 Identity:107/388 - (27%)
Similarity:147/388 - (37%) Gaps:112/388 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QLRVSHGCVSKI--LNRYQETGSIRPGVIGGSKPKVTSPEIETRIDELRKENPSIF-SWEIREKL 122
            :|:::...:..|  ...|||..|.:                .|.|:|  :|...|. ...:..|.
Zfish    87 KLKITEASIVNISRAGSYQEHASCK----------------NTPINE--EEGADICGETNVTLKQ 133

  Fly   123 IKEGFADPPSTSSISRLLRGSDRGSEDGRKDYTINGILGGRDSDISDTESEPGIPLKRKQRRSRT 187
            .:|.|......:|:|   .|||  :|||.                          |||||||.||
Zfish   134 EREAFLKNSEETSLS---AGSD--TEDGM--------------------------LKRKQRRYRT 167

  Fly   188 TFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLRKHSGGSNSGLSPMN 252
            |||:.|||.|||||.:|.||||:||||||....|||||:||||.||||:.||..           
Zfish   168 TFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKRE----------- 221

  Fly   253 SGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTTATGAGMNDGVHHAAHAPSSHHSAATA 317
                    .||:...|..|.|        :|..||..:.......|..|      |:.|.:..:|
Zfish   222 --------KVGVQPHTLSLHY--------SGAPPAAQSLCHYLSGNPFV------PNPHPAIDSA 264

  Fly   318 AAAAHHHTQMGGYDLVQSAAQHGFPGGFAQ---PGHFGSQNYYHQDYSKLTIDDFSKLTADSVSK 379
            ..|....       |.|.|.....|.||:.   ...|....:::..:.:|    |:.|...::.:
Zfish   265 WPAPFQR-------LAQPAQNSVSPPGFSALLGAAMFRHPAFFNPTFGRL----FTSLGPMALQR 318

  Fly   380 IS-PSL-------HLSDNYSKLEAPSNWS-----QAAYHAAANYNAHVAQHQLNDYAAAAAHG 429
            |. |::       ||:.:......|...|     :|:..||....|.....||....||...|
Zfish   319 IPLPAIEGPIQRSHLTTSLLSSSPPLPSSPTVDLRASSIAALRLKAKEHSAQLTHITAAGTAG 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709 16/82 (20%)
Homeobox 185..238 CDD:278475 37/52 (71%)
arxbXP_002667096.1 Homeobox 166..218 CDD:278475 37/51 (73%)
OAR 351..368 CDD:281777 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.