DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and pax10

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001373372.1 Gene:pax10 / 100192208 ZFINID:ZDB-GENE-081022-10 Length:275 Species:Danio rerio


Alignment Length:293 Identity:82/293 - (27%)
Similarity:119/293 - (40%) Gaps:73/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 GILGGRDSDISDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALT 222
            |::.|...::.|  |:..:.||||.:|:||:||.||::|||:.|.||.||||:.||.||....|.
Zfish    52 GVVQGERDEVDD--SQLHLQLKRKLQRNRTSFTQEQIDALEKEFERTHYPDVFARERLAAKIDLP 114

  Fly   223 EARIQVWFSNRRARLRKHSGGSNSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPA 287
            |||||||||||||:.|:.....|.    ..||||:     ..|....||                
Zfish   115 EARIQVWFSNRRAKWRREEKLRNQ----RRSGSSS-----SCSQTHTPL---------------- 154

  Fly   288 PGTTATGAGMNDGVHHAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPGHFG 352
                  ....|..|:|      ||||.::.:..:...:.:.||..:..               |.
Zfish   155 ------STSFNSPVYH------SHHSNSSGSMHSRSDSSLSGYSSLSV---------------FS 192

  Fly   353 SQNYYHQDYSKLTIDDFSKLTADSVSKISP-SLHLSDNYSKLEAPSNWSQAAYHAAANYNAHVAQ 416
            |.    |.....:...:|.:...|.|.:.| |.....:|:....|...:     |:||       
Zfish   193 SM----QSLPSQSTPTYSCMLPPSPSALPPLSRKFDSSYTSPHLPPPPT-----ASAN------- 241

  Fly   417 HQLNDYAAAAAHGNPASAYSHPLPTQGQAKYWS 449
              ...:|..:|.|..|.........||.::||:
Zfish   242 --TGFFAGVSAAGQTAVQGGDQELGQGLSQYWT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 34/52 (65%)
pax10NP_001373372.1 Homeobox 78..131 CDD:395001 34/52 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.