DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gsb-n and sia1

DIOPT Version :9

Sequence 1:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001090821.1 Gene:sia1 / 100038038 XenbaseID:XB-GENE-482368 Length:240 Species:Xenopus tropicalis


Alignment Length:80 Identity:30/80 - (37%)
Similarity:43/80 - (53%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRA 235
            :::..:.....:.|.||.::.||...|:..|....|||...|..:|:.||:.|.||||||.||||
 Frog   125 QADEAVAAPSARSRRRTIYSKEQTHFLQNQFDLNPYPDFVNRCRIAKITAIPEPRIQVWFQNRRA 189

  Fly   236 RLRKHSGGSNSGLSP 250
            |   |...:.:.|||
 Frog   190 R---HLPRAATSLSP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 25/52 (48%)
sia1NP_001090821.1 homeodomain 138..191 CDD:238039 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..240 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.