DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment uzip and CG13321

DIOPT Version :10

Sequence 1:NP_523861.1 Gene:uzip / 38002 FlyBaseID:FBgn0004055 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_610831.1 Gene:CG13321 / 36430 FlyBaseID:FBgn0033787 Length:286 Species:Drosophila melanogaster


Alignment Length:32 Identity:12/32 - (37%)
Similarity:15/32 - (46%) Gaps:7/32 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKN 41
            :.:.|.|   |.|..||:    ||||....||
  Fly   373 VEINNQP---RIKLSQDV----GKVTMPGSKN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
uzipNP_523861.1 PFM_unzipped-like 233..367 CDD:380803
putative membrane-spanning region 260..300 CDD:380803
putative variable loop region 325..355 CDD:380803
CG13321NP_610831.1 DUF3421 26..135 CDD:463390
DUF3421 168..277 CDD:463390
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.