| Sequence 1: | NP_523861.1 | Gene: | uzip / 38002 | FlyBaseID: | FBgn0004055 | Length: | 488 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610831.1 | Gene: | CG13321 / 36430 | FlyBaseID: | FBgn0033787 | Length: | 286 | Species: | Drosophila melanogaster |
| Alignment Length: | 32 | Identity: | 12/32 - (37%) |
|---|---|---|---|
| Similarity: | 15/32 - (46%) | Gaps: | 7/32 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKN 41 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| uzip | NP_523861.1 | PFM_unzipped-like | 233..367 | CDD:380803 | |
| putative membrane-spanning region | 260..300 | CDD:380803 | |||
| putative variable loop region | 325..355 | CDD:380803 | |||
| CG13321 | NP_610831.1 | DUF3421 | 26..135 | CDD:463390 | |
| DUF3421 | 168..277 | CDD:463390 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||