DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zip and SPAC25B8.08

DIOPT Version :9

Sequence 1:NP_523860.2 Gene:zip / 38001 FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:NP_594468.1 Gene:SPAC25B8.08 / 2542659 PomBaseID:SPAC25B8.08 Length:590 Species:Schizosaccharomyces pombe


Alignment Length:417 Identity:89/417 - (21%)
Similarity:157/417 - (37%) Gaps:97/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1226 DLSEELEALKNELLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGV--LADMRHKHSQEL 1288
            ||:.:::...:||::||..|..|..:|...|        :|||..|.:.|:  |.|:....|..|
pombe   239 DLTVDIQNRCSELMNSLYITICQDAMRRMNE--------NLEEGMVKYTGIQGLEDILRSRSWNL 295

  Fly  1289 NSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRRKQAESQIAELQVKLAE 1353
                     ||:..|             .|.:|..||..|:       ..::.::|....:.|.|
pombe   296 ---------LRRRPT-------------NDASTSPRSTPSA-------SPRSITKIIASTLHLLE 331

  Fly  1354 IERARSELQEKCTK-----LQQEAENITNQLEEAELKASAAVKSASNMESQLTEAQQLLEEETRQ 1413
            :......::.:|.:     |.....||... .:..|..:||:::..|: |.|.|..|....:.::
pombe   332 VFYIHPLIRAQCIEQLFSWLGARLFNIVIS-NKKYLSRAAAMETRFNI-SSLEEWSQTNSPKLQK 394

  Fly  1414 ---------KLGLSSKLRQIESEKEALQ--EQLEEDDEAKRNYERKLAEVTTQMQEIKKKAEEDA 1467
                     |:.|.|||..:....:.||  .:|.||::     .|.|.|....:..:..:....|
pombe   395 PFDYPDEDLKVDLISKLLSLVQLLQWLQCLYRLSEDED-----PRALQETLESLDALNPRQIYTA 454

  Fly  1468 DLAK----ELEEGK--KRLNKDIEAL-ERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTK 1525
              ||    ::.|.|  |...|.::|. |.:::|.|..:|:.|.|.:                   
pombe   455 --AKLYRPDITETKVSKTFLKKLDAFHEEKLREKINSSDKGDVSYE------------------- 498

  Fly  1526 VLELEKKQKNFDKILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIED--LENK 1588
             .||.|.:..|..:....||  :.|.............::.|::......:...||:|:  |..:
pombe   499 -FELLKDETVFSPLKLPTKA--QLINAYSYIVSGNGFNEDRKIVFQPHVSNILIDKLEENGLSME 560

  Fly  1589 RKTLQNEL--DDLANTQGTADKNVHEL 1613
            |..|...:  |:|...:...|:.|.||
pombe   561 RAELPTSVFEDELQRREWRPDQEVEEL 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832
Myosin_head 133..854 CDD:278492
MYSc_Myh2_insects_mollusks 145..854 CDD:276876
Myosin_tail_1 931..2011 CDD:279860 89/417 (21%)
Prefoldin 1431..1515 CDD:298833 22/92 (24%)
FAM76 <1847..1926 CDD:292665
SPAC25B8.08NP_594468.1 Myo5p-like_CBD_DIL_ANK 140..524 CDD:271257 76/352 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000014
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.