DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zip and Prm

DIOPT Version :10

Sequence 1:NP_523860.2 Gene:zip / 38001 FlyBaseID:FBgn0287873 Length:2056 Species:Drosophila melanogaster
Sequence 2:XP_314309.4 Gene:Prm / 1275082 VectorBaseID:AGAMI1_012025 Length:882 Species:Anopheles gambiae


Alignment Length:31 Identity:9/31 - (29%)
Similarity:12/31 - (38%) Gaps:4/31 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 WQPYQYLVESIRKFPQQNEFKAMIQNAGFKC 279
            |.|..|..:    :|.|.|........||:|
Mosquito   131 WNPATYKCD----WPDQVEDCDAEAFLGFRC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 79..122 CDD:460670
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 9/31 (29%)
Myosin_tail_1 931..2011 CDD:460256
PrmXP_314309.4 Myosin_tail_1 <30..852 CDD:460256 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.