DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment zip and LOC101884494

DIOPT Version :9

Sequence 1:NP_523860.2 Gene:zip / 38001 FlyBaseID:FBgn0265434 Length:2056 Species:Drosophila melanogaster
Sequence 2:XP_005174715.1 Gene:LOC101884494 / 101884494 -ID:- Length:171 Species:Danio rerio


Alignment Length:166 Identity:120/166 - (72%)
Similarity:145/166 - (87%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KYLSVERNQFNDPATQAEWTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDI 122
            |:|.|:||..|:|..||:|..|:|||||.|..||.|.|:|.||||||.||||::||::.:.:|||
Zfish     6 KFLYVDRNLVNNPLAQADWATKKLVWVPSERLGFEAGSLKEEHGDEVVVELADSGKKIRVNKDDI 70

  Fly   123 QKMNPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYKKLPIYTEKIMER 187
            ||||||||.|||||||||||||||||||:|:|||||||||||||||||:||||.||||:|:|::.
Zfish    71 QKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLPIYSEEIVDM 135

  Fly   188 YKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCT 223
            |||.||||:|||::||||:|||:|:.||||||||||
Zfish   136 YKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
zipNP_523860.2 Myosin_N 80..117 CDD:280832 23/36 (64%)
Myosin_head 133..854 CDD:278492 74/91 (81%)
MYSc_Myh2_insects_mollusks 145..854 CDD:276876 62/79 (78%)
Myosin_tail_1 931..2011 CDD:279860
Prefoldin 1431..1515 CDD:298833
FAM76 <1847..1926 CDD:292665
LOC101884494XP_005174715.1 Myosin_N 28..66 CDD:280832 23/37 (62%)
Motor_domain 93..>171 CDD:277568 60/77 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D40305at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.