DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACAT1 and yip2

DIOPT Version :9

Sequence 1:NP_001373606.1 Gene:ACAT1 / 38 HGNCID:93 Length:434 Species:Homo sapiens
Sequence 2:NP_523528.1 Gene:yip2 / 34313 FlyBaseID:FBgn0040064 Length:398 Species:Drosophila melanogaster


Alignment Length:400 Identity:149/400 - (37%)
Similarity:227/400 - (56%) Gaps:16/400 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    40 KEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGG--EGQA 102
            |.:.||:|.||..|:|.|||..:..|:|.:.|.:.|::.||:..|:|....:|||:...  :|..
  Fly     6 KGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIY 70

Human   103 PTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNR-- 165
            ..|...|..|:||..|...||::|.||.::|:..:|.::.|...:.:.||:|:||..|::...  
  Fly    71 VPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIARNVR 135

Human   166 -GSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAG 229
             |:|......|||.:.. ||||.|.|:.|...|||.|.:..|:|...|.:::.|....:...:.|
  Fly   136 FGTTLGASYNLEDALWA-GLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEKGQKEG 199

Human   230 KFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALV 294
            .|..|:.|:.:.|||:....|.::....:.....:.||.::| |:||.|||..||.:.|||:|::
  Fly   200 AFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLF-KKNGVVTAGTASGICDGASAVI 263

Human   295 LMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLV 359
            :.:.:|.|..|:.||||:|||:...|:|....|.||.|...|||..|.|.|||.:.|:||||:..
  Fly   264 VASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLIEINEAFAAQ 328

Human   360 VLANIKMLEIDPQKVNINGGAVSLGHPIGKCFLNFRMSGARIVGHLTHAL--KQGEYGLASICNG 422
            .||....|::|..|:|:||||::||||:|       .||:||.|||.|.|  |:.:||:.|.|.|
  Fly   329 TLACADALKLDTSKLNVNGGAIALGHPLG-------ASGSRITGHLVHELQRKKLKYGIGSACIG 386

Human   423 GGGASAMLIQ 432
            ||...|:|::
  Fly   387 GGQGIALLLE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACAT1NP_001373606.1 thiolase 43..433 CDD:238383 148/396 (37%)
Coenzyme A binding. /evidence=ECO:0000269|PubMed:17371050 258..260 0/1 (0%)
yip2NP_523528.1 PRK05790 6..398 CDD:180261 149/399 (37%)
thiolase 9..397 CDD:238383 148/396 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321628at33208
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.