DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2736 and SCARB1

DIOPT Version :9

Sequence 1:NP_611991.1 Gene:CG2736 / 37998 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001354910.1 Gene:SCARB1 / 949 HGNCID:1664 Length:552 Species:Homo sapiens


Alignment Length:508 Identity:118/508 - (23%)
Similarity:211/508 - (41%) Gaps:112/508 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLCLILACVNVFLFVVSWGVDYRILVAREHIRFRQEMPTMDSW--INSPFGKLKNYVFNVTNAEE 72
            |||.:|..  |.:.:|...:..::|   :::|......:.:.|  |..|| .|..|.|:|.|..|
Human    19 LLCAVLGA--VMIVMVPSLIKQQVL---KNVRIDPSSLSFNMWKEIPIPF-YLSVYFFDVMNPSE 77

  Fly    73 FRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKH------RYRVVEFLPEES------- 124
            ...|  .:.:|:|.||.|||..       |:::|:.:..:      .||..:|.|.:|       
Human    78 ILKG--EKPQVRERGPYVYREF-------RHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDY 133

  Fly   125 -VAPDVLNWTITSTNNVILGAATKVKH---------TAPLAAFGFDAALMMEDIFVTDSVYYFLW 179
             |.|::|          :||||..:::         |......|       |..|:..:|...:|
Human   134 IVMPNIL----------VLGAAVMMENKPMTLKLIMTLAFTTLG-------ERAFMNRTVGEIMW 181

  Fly   180 EFTRPLLQTLSRISNIRPNV----------AVLYNALKEKEEVYTVNIGPKRGIENFFRIETL-- 232
            .:..||:..:::..   |.:          |.|.|:......|:|       |::|..||..:  
Human   182 GYKDPLVNLINKYF---PGMFPFKDKFGLFAELNNSDSGLFTVFT-------GVQNISRIHLVDK 236

  Fly   233 -NGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQER 296
             ||       |.....:.|:.|  |:.......::|||:.|::.|...:.|:||.:.|.|:....
Human   237 WNG-------LSKVDFWHSDQC--NMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGV 292

  Fly   297 YNGLDTFRY----TLLQSHQ-KPPG-----CLDTSYGVKLPDGMFDVSQCVINDAPSAFSMPHFY 351
            :.|:.|:|:    ||..:.. .||.     ||::        |:.:||.|..: ||...|.|||.
Human   293 FEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLES--------GIQNVSTCRFS-APLFLSHPHFL 348

  Fly   352 GSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIP 416
            .:....::...|..||.|.|..::.:.||||||:....:.|.::.:..:... .:..:...:::|
Human   349 NADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGI-GQTGKIEPVVLP 412

  Fly   417 SFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLKAIRVAC 469
            ..|:. |.|.:.|......:..:.::..:..|..  :::|||..||..:.|.|
Human   413 LLWFA-ESGAMEGETLHTFYTQLVLMPKVMHYAQ--YVLLALGCVLLLVPVIC 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 114/499 (23%)
SCARB1NP_001354910.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.