DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2736 and Snmp1

DIOPT Version :9

Sequence 1:NP_611991.1 Gene:CG2736 / 37998 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001262803.1 Gene:Snmp1 / 42514 FlyBaseID:FBgn0260004 Length:551 Species:Drosophila melanogaster


Alignment Length:512 Identity:119/512 - (23%)
Similarity:201/512 - (39%) Gaps:102/512 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VQWVKILLCLILACVNVFLFVVSWGVDYRIL--VAREHIRFRQEMPTMDSWINSPFG-KLKNYVF 65
            :|..::.|.:....:.||..:..|.:..:||  :..:.:..:......:.|.|:||. ....|||
  Fly     1 MQVPRVKLLMGSGAMFVFAIIYGWVIFPKILKFMISKQVTLKPGSDVRELWSNTPFPLHFYIYVF 65

  Fly    66 NVTNAEEFRSGRDSRLKVKEIGPIVYRIVGFNDILDRNETNVRYRKHRYRVVEFLPEESVAPDVL 130
            ||||.:|...|...||  :|:||.|     |::..|:.:.                |:.|..|.:
  Fly    66 NVTNPDEVSEGAKPRL--QEVGPFV-----FDEWKDKYDL----------------EDDVVEDTV 107

  Fly   131 NWT--------------ITSTNNVIL--------GAATKVKHTAPLA------------AFGFDA 161
            ::|              :|....:||        |.:.:.:..|.:.            |..|..
  Fly   108 SFTMRNTFIFNPKESLPLTGEEEIILPHPIMLPGGISVQREKAAMMELVSKGLSIVFPDAKAFLK 172

  Fly   162 ALMMEDIFVTDSVYYFLWEFTRPLLQTLSRISNIRPNVAV-----LYNALKEKEEVYTVNIGPKR 221
            |..|:..|...:|.....||:...|.|:.....|:....|     |::.:.:.....:......|
  Fly   173 AKFMDLFFRGINVDCSSEEFSAKALCTVFYTGEIKQAKQVNQTHFLFSFMGQANHSDSGRFTVCR 237

  Fly   222 GIENFFRIETLNGEVIIREQLPHTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRV 286
            |::|..::    |:|:.....|....:....|  |.....|:::|.|.::.:..|.....:.||.
  Fly   238 GVKNNKKL----GKVVKFADEPEQDIWPDGEC--NTFVGTDSTVFAPGLKKEDGLWAFTPDLCRS 296

  Fly   287 LPLTYQRQERYNGLDTFRYTL----LQSHQK------PPGCLDTSYGVKLPDGMFDVSQCVINDA 341
            |...||.:..|:|:.:.||||    :::.:|      .|..|||.    .|.|..:::.||  ..
  Fly   297 LGAYYQHKSSYHGMPSMRYTLDLGDIRADEKLHCFCEDPEDLDTC----PPKGTMNLAACV--GG 355

  Fly   342 PSAFSMPHFYGSSYNWSQHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSR 406
            |...||||||..........:|..||.:||..||..|.::|.|.....|.|.|:.:..:..... 
  Fly   356 PLMASMPHFYLGDPKLVADVDGLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEP- 419

  Fly   407 LSRFSNMMIPSFWYEFEMGQLPGFVTSLMWINVNIVQHIQPYCMVLFLVLALWSVLK 463
            :.....:::|.||.| |..||....|       |:|::      .|||.|.:.|||:
  Fly   420 MKNLPKLILPMFWVE-EGVQLNKTYT-------NLVKY------TLFLGLKINSVLR 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 116/503 (23%)
Snmp1NP_001262803.1 CD36 12..478 CDD:279474 117/501 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.