DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2736 and santa-maria

DIOPT Version :9

Sequence 1:NP_611991.1 Gene:CG2736 / 37998 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_609121.2 Gene:santa-maria / 34024 FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster


Alignment Length:529 Identity:115/529 - (21%)
Similarity:222/529 - (41%) Gaps:79/529 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KILLCLILACVNVF--LFVVSWGVDYRILVAREHIRFRQEMPTMDSWINSPFG-KLKNYVFNVTN 69
            |:::.:...|:.:|  |..:.| ||....:..:.:....:....::|.:.|.. .|..|::|.||
  Fly    16 KLIIGIFGFCLGLFGILCGMFW-VDLFDWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTN 79

  Fly    70 AEEFRSGRDSRLKVKEIGPIVYRIVGFNDILD----RNETNVRYRKHRYRVVEFLPEESVAPDVL 130
            .|:| ....::..::::||  ||.:...|.:|    ....:|.||:...    |..:.:.:...|
  Fly    80 PEDF-GNLSTKPILEQVGP--YRFIERPDKVDIHWHPENASVTYRRRSL----FYFDAAGSNGSL 137

  Fly   131 NWTITSTNNVILGAATKVKHTAPLAAFGFDAALMM--EDIFVTDSVYYFLWEFTRPLLQTLSRIS 193
            :..||:.|.|.|.||...|:..|:.....|..|.|  .::.|..|:...|:          :..:
  Fly   138 DDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKSIDELLF----------TGYN 192

  Fly   194 NIRPNVAVLYNALKEKEEV--------YTVN-IGPKRGIENFFRIETLNGEVIIREQLPHTRQYD 249
            :...:||:......::.:|        ||.| .....|:.|.|    ...:.:.:....|:..|.
  Fly   193 DAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFNVF----TGADQLAKLGQMHSWNYQ 253

  Fly   250 SNSCPFNVSGALDN----SLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTLLQS 310
            .|:..|:....:.|    ...|..::|...:.:...:.||.:||.|.......||:.::::    
  Fly   254 ENTGFFDSYCGMTNGSAGEFQPQHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFS---- 314

  Fly   311 HQKPPGCLD--TSY--------GVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYEGYT 365
              ..|..:|  |.|        |..:|.|:.::|.|... :|...|.|||:.:...:....||.:
  Fly   315 --GGPRSVDNGTQYPENLCFCGGQCVPSGVMNISSCRFG-SPVFMSYPHFFNADPYYPDQVEGLS 376

  Fly   366 PNAEDHEPYILLEPVTGIPVTEKYRFQSNI---PIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQL 427
            ||.:|||.|::::|.||||:....|||.|:   ||..:..::.    ...:..|..|:|.::...
  Fly   377 PNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTG----IPRIFFPLVWFEQKVRIT 437

  Fly   428 PGFVTSLMWINVNIVQ-HI-QPYCMVLFLVLALWSVLKAIRVACGDLGYVVLFRKLCGDLGTVTA 490
            |.....|..:.:.::. || ...|:::.:.|..|:.::.:..:|.:..|         ||.|.|.
  Fly   438 PDMADQLKVLPIVMLSGHIFAGICLIVGITLLCWTPVQILLASCRNRRY---------DLRTKTK 493

  Fly   491 LETKFQATS 499
            ...::::.|
  Fly   494 TNGQYKSRS 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 107/488 (22%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 107/483 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450754
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.