DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2736 and Cd36

DIOPT Version :9

Sequence 1:NP_611991.1 Gene:CG2736 / 37998 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_113749.2 Gene:Cd36 / 29184 RGDID:2301 Length:472 Species:Rattus norvegicus


Alignment Length:405 Identity:98/405 - (24%)
Similarity:162/405 - (40%) Gaps:82/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YVFNVTNAEEFRSGRDSRLKVKEIGPIVYRI---VGFNDILDRNETNVRYRKHRYRVVEFLPEES 124
            ::|:|.|.||. :...|::|||:.||..||:   ...|...|..::.|.:.:....:.|  |..|
  Rat    66 WIFDVQNPEEV-AKNSSKIKVKQRGPYTYRVRYLAKENITQDPKDSTVSFVQPNGAIFE--PSLS 127

  Fly   125 VAPDVLNWTITS----------TNNVILGAATK-VKHTAPLAAFGFDAALMMEDIFVTDSVYYFL 178
            |..:..|:|:.:          ||:.:.|.... :|.:             ...:|.|.|:...|
  Rat   128 VGTENDNFTVLNLAVAAAPHIYTNSFVQGVLNSLIKKS-------------KSSMFQTRSLKELL 179

  Fly   179 WEFTRPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLP 243
            |.:..|.|..:.  ..|...|.|.|......:.||.|..| |..|.....|:|..|    :..|.
  Rat   180 WGYKDPFLSLVP--YPISTTVGVFYPYNNTVDGVYKVFNG-KDNISKVAIIDTYKG----KRNLS 237

  Fly   244 HTRQYDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTL- 307
            :...|    |.. ::|. |.:.|||||:....|...:.:.||.:...:..:....|:..:|:.| 
  Rat   238 YWESY----CDM-INGT-DAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEVNLKGIPVYRFVLP 296

  Fly   308 -------LQSHQKPPGCLD-------TSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWS 358
                   ||:......|.:       |||||      .|:.:|. ...|...|:|||..:|.:.|
  Rat   297 ANAFASPLQNPDNHCFCTEKVISNNCTSYGV------LDIGKCK-EGKPVYISLPHFLHASPDVS 354

  Fly   359 QHYEGYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFE 423
            :..||..||.::|..|:.:||:||..:....|.|.||.:...|    ::....|:..|       
  Rat   355 EPIEGLNPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPAR----KIEALKNLKRP------- 408

  Fly   424 MGQLPGFVTSLMWIN 438
                  ::..::|:|
  Rat   409 ------YIVPILWLN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 98/405 (24%)
Cd36NP_113749.2 CD36 14..463 CDD:395898 98/405 (24%)
Required for interaction with thrombospondins, THBS1 and THBS2. /evidence=ECO:0000250 93..120 5/26 (19%)
Interaction with PTK2, PXN and LYN. /evidence=ECO:0000250|UniProtKB:P16671 460..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.