DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2736 and Cd36

DIOPT Version :9

Sequence 1:NP_611991.1 Gene:CG2736 / 37998 FlyBaseID:FBgn0035090 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_001153027.1 Gene:Cd36 / 12491 MGIID:107899 Length:472 Species:Mus musculus


Alignment Length:401 Identity:96/401 - (23%)
Similarity:162/401 - (40%) Gaps:74/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YVFNVTNAEEFRSGRDSRLKVKEIGPIVYRI---VGFNDILDRNETNVRYRKHRYRVVEFLPEES 124
            ::|:|.|.::. :...|::|||:.||..||:   ...|...|..:..|.:.:....:.|  |..|
Mouse    66 WIFDVQNPDDV-AKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFE--PSLS 127

  Fly   125 VAPDVLNWTITSTNNVILGAATKVKHTAPLAAFGFDAALM-------MEDIFVTDSVYYFLWEFT 182
            |..:..|:|:.   |:.:.||..:...:      |...::       ...:|.|.|:...||.:.
Mouse   128 VGTEDDNFTVL---NLAVAAAPHIYQNS------FVQVVLNSLIKKSKSSMFQTRSLKELLWGYK 183

  Fly   183 RPLLQTLSRISNIRPNVAVLYNALKEKEEVYTVNIGPKRGIENFFRIETLNGEVIIREQLPHTRQ 247
            .|.|..:.  ..|...|.|.|......:.||.|..| |..|.....||:..|    :..|.:...
Mouse   184 DPFLSLVP--YPISTTVGVFYPYNDTVDGVYKVFNG-KDNISKVAIIESYKG----KRNLSYWPS 241

  Fly   248 YDSNSCPFNVSGALDNSLFPPFVQPDTPLSIVAIESCRVLPLTYQRQERYNGLDTFRYTL----- 307
            |    |.. ::|. |.:.|||||:....|...:.:.||.:...:..:....|:..:|:.|     
Mouse   242 Y----CDM-INGT-DAASFPPFVEKSRTLRFFSSDICRSIYAVFGSEIDLKGIPVYRFVLPANAF 300

  Fly   308 ---LQSHQKPPGCLD-------TSYGVKLPDGMFDVSQCVINDAPSAFSMPHFYGSSYNWSQHYE 362
               ||:......|.:       |||||      .|:.:|. ...|...|:|||..:|.:.|:..|
Mouse   301 ASPLQNPDNHCFCTEKVISNNCTSYGV------LDIGKCK-EGKPVYISLPHFLHASPDVSEPIE 358

  Fly   363 GYTPNAEDHEPYILLEPVTGIPVTEKYRFQSNIPIPDLRRFSSRLSRFSNMMIPSFWYEFEMGQL 427
            |..||.::|..|:.:||:||..:....|.|.||.:...|    ::....|:..|           
Mouse   359 GLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPAR----KIEALKNLKRP----------- 408

  Fly   428 PGFVTSLMWIN 438
              ::..::|:|
Mouse   409 --YIVPILWLN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2736NP_611991.1 CD36 10..462 CDD:279474 96/401 (24%)
Cd36NP_001153027.1 CD36 16..463 CDD:366481 96/401 (24%)
Required for interaction with thrombospondins, THBS1 and THBS2. /evidence=ECO:0000269|PubMed:15748999 93..120 5/26 (19%)
Interaction with PTK2, PXN and LYN. /evidence=ECO:0000250|UniProtKB:P16671 460..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.